Skip to content

samsledje/RocketSHP

Repository files navigation

🚀 RocketSHP: Ultra-fast Prediction of Protein Dynamics

License Python 3.11+ PyTorch Ruff

RocketSHP enables ultra-fast prediction of protein dynamics and flexibility from amino acid sequences and/or protein structures. Trained on thousands of molecular dynamics trajectories, it predicts multiple dynamics-related features simultaneously:

  • Root-Mean-Square Fluctuations (RMSF)
  • Generalized Correlation Coefficients with Linear Mutual Information (GCC-LMI)
  • Structural Heterogeneity Profiles (SHP)

This approach bridges the gap between static structural biology and dynamic functional understanding, providing a computational tool that complements experimental approaches at unprecedented speed and scale.

🛠️ Installation

# Clone the repository
git clone https://github.com/samsledje/RocketSHP.git
cd RocketSHP

# Create and activate a conda environment
mamba create -n rocketshp python=3.11
mamba activate rocketshp

# Install package
pip install -e .

# Check installation
python -c "import rocketshp; print('Success!')"

🚀 Quick Start

With a .pdb file from the command line:

rocketshp_predict example/kras_afdb.pdb RocketSHP_KRAS_Predictions

Python interface:

import torch
from torch.nn.functional import softmax
from rocketshp import RocketSHP, load_sequence, load_structure
from rocketshp.plot import plot_predictions

# Set compute device
device = torch.device("cuda:0")

# Load the model (will download if not present)
model = RocketSHP.load_from_checkpoint("v1_seq").to(device)

# Predict dynamics from sequence only
sequence = "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM"
seq_features = load_sequence(sequence, device=device)
with torch.no_grad():
    dynamics_pred = model({"seq_feats": seq_features, "struct_feats": None})

# Access prediction results
rmsf = dynamics_pred["rmsf"].squeeze().cpu().numpy()
gcc_lmi = dynamics_pred["gcc_lmi"].squeeze().cpu().numpy()
ca_dist = dynamics_pred["ca_dist"].squeeze().cpu().numpy()
shp = softmax(dynamics_pred["shp"].squeeze(), dim=1).cpu().numpy()

# Visualize results
plot_predictions(rmsf, gcc_lmi, shp, "KRAS", "rocketshp_kras.png")

💻 Model Variants

RocketSHP comes in three variants:

  1. RocketSHP - Full model that uses both sequence and structure information
  2. RocketSHP-seq - Sequence-only model trained with the same architecture
  3. RocketSHP-mini - Lightweight sequence-only model (1.5M parameters)
# Load different model variants
full_model = RocketSHP.load_from_checkpoint("latest")  # Latest is also 'v1'
seq_model = RocketSHP.load_from_checkpoint("v1_seq")
mini_model = RocketSHP.load_from_checkpoint("v1_mini")

📈 Using a Structure for Improved Predictions

import torch
from torch.nn.functional import softmax
from rocketshp import RocketSHP, load_sequence, load_structure
from biotite.structure.io import pdb
from biotite.structure import to_sequence

# Set compute device
device = torch.device("cuda:0")

# Load the model
model = RocketSHP.load_from_checkpoint("latest").to(device)

# Load structure file (PDB)
structure_file = "example/kras_afdb.pdb"
structure = pdb.PDBFile.read(structure_file).get_structure()
struct_features = load_structure(structure, device=device)

# Get sequence from structure
sequence = str(to_sequence(structure)[0][0])
seq_features = load_sequence(sequence, device=device)

# Predict dynamics with both sequence and structure
with torch.no_grad():
    dynamics_pred = model({
        "seq_feats": seq_features,
        "struct_feats": struct_features,
    })

🕸️ Building an Allosteric Network

from rocketshp.network import build_allosteric_network, cluster_network, calculate_centrality, plot_network_clusters

# Build network from GCC-LMI predictions and distance mask
gcc_lmi = dynamics_pred["gcc_lmi"].squeeze().cpu().numpy()
ca_dist = dynamics_pred["ca_dist"].squeeze().cpu().numpy()  # Predicted CA distances
network = build_allosteric_network(gcc_lmi, ca_dist, distance_cutoff=10.0)

# Apply clustering to identify communities
communities = cluster_network(network, k=5)

# Calculate betweenness centrality
centralities = calculate_centrality(network)
betweenness_centrality = centralities["betweenness"]
closeness_centrality = centralities["closeness"]
degree_centrality = centralities["degree"]

# Visualize network
from rocketshp.network import plot_network_clusters
plot_network_clusters(network, communities, output_path="rocketshp_kras_network.png")

🔎 Model Details

RocketSHP leverages ESM3 for sequence and structure representations, feeding these through a transformer encoder to predict multiple dynamics properties:

  • Architecture: Transformer encoder with specialized prediction heads
  • Sequence Input: ESM3 embeddings (frozen)
  • Structure Input: ESM3 structure embeddings (optional, three variants available)
  • Output Heads:
    • RMSF: Linear prediction of per-residue flexibility
    • GCC-LMI: Pairwise correlation estimation with sigmoid activation
    • SHP: Categorical distribution over structure tokens representing different conformational states

For more technical details, please refer to our paper.

📝 Citation

If you use RocketSHP in your research, please cite:

@article{sledzieski2025rocketshp,
  title={RocketSHP: Ultra-fast Proteome-scale Prediction of Protein Dynamics},
  author={Sledzieski, Samuel and Hanson, Sonya M},
  journal={bioRxiv},
  pages={2025--06},
  year={2025},
  publisher={Cold Spring Harbor Laboratory}
}

⚖️ License

This project is licensed under the MIT License - see the LICENSE.md file for details.

About

For the most up-to-date version of RocketSHP, see our Flatiron Institute repository:

Resources

License

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors